Skip to content
Snippets Groups Projects
Commit 527a608d authored by Tim O'Donnell's avatar Tim O'Donnell
Browse files

Working on docs

parent dfe14dd9
No related merge requests found
from __future__ import print_function from __future__ import print_function
from os.path import join, exists, abspath from os.path import join, exists
from os import mkdir, environ from os import mkdir
from socket import gethostname from socket import gethostname
from getpass import getuser from getpass import getuser
import time import time
import collections import collections
import json
import hashlib
import logging import logging
from six import string_types from six import string_types
...@@ -17,7 +15,6 @@ import pandas ...@@ -17,7 +15,6 @@ import pandas
import sklearn import sklearn
import sklearn.linear_model import sklearn.linear_model
import mhcnames
try: try:
import tqdm import tqdm
...@@ -30,9 +27,7 @@ from .class1_processing_predictor import Class1ProcessingPredictor ...@@ -30,9 +27,7 @@ from .class1_processing_predictor import Class1ProcessingPredictor
from .class1_neural_network import DEFAULT_PREDICT_BATCH_SIZE from .class1_neural_network import DEFAULT_PREDICT_BATCH_SIZE
from .encodable_sequences import EncodableSequences from .encodable_sequences import EncodableSequences
from .regression_target import from_ic50, to_ic50 from .regression_target import from_ic50, to_ic50
from .multiple_allele_encoding import MultipleAlleleEncoding
from .downloads import get_default_class1_presentation_models_dir from .downloads import get_default_class1_presentation_models_dir
from .common import load_weights
MAX_ALLELES_PER_SAMPLE = 6 MAX_ALLELES_PER_SAMPLE = 6
...@@ -41,6 +36,12 @@ PREDICT_CHUNK_SIZE = 100000 # currently used only for cleavage prediction ...@@ -41,6 +36,12 @@ PREDICT_CHUNK_SIZE = 100000 # currently used only for cleavage prediction
class Class1PresentationPredictor(object): class Class1PresentationPredictor(object):
"""
A logistic regression model over predicted binding affinity (BA) and antigen
processing (AP) score.
See load() and predict() methods for basic usage.
"""
model_inputs = ["affinity_score", "processing_score"] model_inputs = ["affinity_score", "processing_score"]
def __init__( def __init__(
...@@ -61,10 +62,16 @@ class Class1PresentationPredictor(object): ...@@ -61,10 +62,16 @@ class Class1PresentationPredictor(object):
@property @property
def supported_alleles(self): def supported_alleles(self):
"""
List of alleles supported by the underlying Class1AffinityPredictor
"""
return self.affinity_predictor.supported_alleles return self.affinity_predictor.supported_alleles
@property @property
def supported_peptide_lengths(self): def supported_peptide_lengths(self):
"""
(min, max) of supported peptide lengths, inclusive.
"""
return self.affinity_predictor.supported_peptide_lengths return self.affinity_predictor.supported_peptide_lengths
def predict_affinity( def predict_affinity(
...@@ -75,6 +82,21 @@ class Class1PresentationPredictor(object): ...@@ -75,6 +82,21 @@ class Class1PresentationPredictor(object):
include_affinity_percentile=False, include_affinity_percentile=False,
verbose=1, verbose=1,
throw=True): throw=True):
"""
Parameters
----------
peptides
experiment_names
alleles
include_affinity_percentile
verbose
throw
Returns
-------
"""
df = pandas.DataFrame({ df = pandas.DataFrame({
"peptide": numpy.array(peptides, copy=False), "peptide": numpy.array(peptides, copy=False),
"experiment_name": numpy.array(experiment_names, copy=False), "experiment_name": numpy.array(experiment_names, copy=False),
...@@ -242,14 +264,62 @@ class Class1PresentationPredictor(object): ...@@ -242,14 +264,62 @@ class Class1PresentationPredictor(object):
self, self,
sequences, sequences,
alleles, alleles,
result="best", # or "all" or "filtered" result="best",
comparison_quantity="presentation_score", comparison_quantity="presentation_score",
comparison_value=None, filter_value=None,
peptide_lengths=[8, 9, 10, 11], peptide_lengths=[8, 9, 10, 11],
use_flanks=True, use_flanks=True,
include_affinity_percentile=False, include_affinity_percentile=False,
verbose=1, verbose=1,
throw=True): throw=True):
"""
Predict across protein sequences.
Parameters
----------
sequences : str, list of string, or string -> string dict
Protein sequences. If a dict is given, the keys are arbitrary (
e.g. protein names), and the values are the amino acid sequences.
alleles : str, list of string, list of list of string, or string -> string dict
MHC I alleles. Can be: (1) a string (a single allele), (2) a list of
strings (a single genotype), (3) a list of list of strings
(multiple genotypes, where the total number of genotypes must equal
the number of sequences), or (4) a dict (in which case the keys must
match the sequences dict keys).
result : string
One of:
- "best": return the strongest peptide for each sequence
- "all": return predictions for all peptides
- "filtered": return predictions stronger where comparison_quantity
is stronger than filter_value.
comparison_quantity : string
One of "presentation_score", "processing_score", or "affinity".
Quantity to use to rank (if result is "best") or filter (if result
is "filtered") results.
filter_value : float
Threshold value to use, only relevant when result is "filtered".
If comparison_quantity is "affinity", then all results less than
(i.e. tighter than) the specified nM affinity are retained. If it's
"presentation_score" or "processing_score" then results greater than
the indicated filter_value are retained.
peptide_lengths : list of int
Peptide lengths to predict for.
use_flanks : bool
Whether to include flanking sequences when running the AP predictor
(for better cleavage prediction).
include_affinity_percentile : bool
Whether to include affinity percentile ranks in output.
verbose : int
Set to 0 for quiet mode.
throw : boolean
Whether to throw exceptions (vs. log warnings) on invalid inputs.
Returns
-------
pandas.DataFrame with columns:
peptide, n_flank, c_flank, sequence_name, affinity, best_allele,
processing_score, presentation_score
"""
processing_predictor = self.processing_predictor_with_flanks processing_predictor = self.processing_predictor_with_flanks
if not use_flanks or processing_predictor is None: if not use_flanks or processing_predictor is None:
...@@ -339,11 +409,11 @@ class Class1PresentationPredictor(object): ...@@ -339,11 +409,11 @@ class Class1PresentationPredictor(object):
elif result == "filtered": elif result == "filtered":
if comparison_is_score: if comparison_is_score:
result_df = result_df.loc[ result_df = result_df.loc[
result_df[comparison_quantity] >= comparison_value result_df[comparison_quantity] >= filter_value
] ]
else: else:
result_df = result_df.loc[ result_df = result_df.loc[
result_df[comparison_quantity] <= comparison_value result_df[comparison_quantity] <= filter_value
] ]
elif result == "all": elif result == "all":
pass pass
......
...@@ -158,7 +158,7 @@ def test_downloaded_predictor(): ...@@ -158,7 +158,7 @@ def test_downloaded_predictor():
scan_results2 = PRESENTATION_PREDICTOR.predict_sequences( scan_results2 = PRESENTATION_PREDICTOR.predict_sequences(
result="filtered", result="filtered",
comparison_value=500, filter_value=500,
comparison_quantity="affinity", comparison_quantity="affinity",
sequences={ sequences={
"seq1": "MESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGVLPQLE", "seq1": "MESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGVLPQLE",
...@@ -180,7 +180,7 @@ def test_downloaded_predictor(): ...@@ -180,7 +180,7 @@ def test_downloaded_predictor():
scan_results3 = PRESENTATION_PREDICTOR.predict_sequences( scan_results3 = PRESENTATION_PREDICTOR.predict_sequences(
result="filtered", result="filtered",
comparison_value=0.9, filter_value=0.9,
comparison_quantity="presentation_score", comparison_quantity="presentation_score",
sequences={ sequences={
"seq1": "MESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGVLPQLE", "seq1": "MESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGVLPQLE",
......
0% Loading or .
You are about to add 0 people to the discussion. Proceed with caution.
Finish editing this message first!
Please register or to comment